Lineage for d5m7ef1 (5m7e F:1-76)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120788Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2120789Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2120790Species Chicken (Gallus gallus) [TaxId:9031] [311384] (51 PDB entries)
  8. 2120802Domain d5m7ef1: 5m7e F:1-76 [330295]
    Other proteins in same PDB: d5m7ea1, d5m7ea2, d5m7eb1, d5m7eb2, d5m7ec1, d5m7ec2, d5m7ed1, d5m7ed2, d5m7ee_, d5m7ef2, d5m7ef3
    automated match to d3tiia1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, sd5

Details for d5m7ef1

PDB Entry: 5m7e (more details), 2.05 Å

PDB Description: tubulin-bkm120 complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5m7ef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7ef1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5m7ef1:

Click to download the PDB-style file with coordinates for d5m7ef1.
(The format of our PDB-style files is described here.)

Timeline for d5m7ef1: