![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) ![]() |
![]() | Family c.1.12.0: automated matches [191427] (1 protein) not a true family |
![]() | Protein automated matches [190614] (15 species) not a true protein |
![]() | Species Streptomyces platensis [TaxId:58346] [330207] (1 PDB entry) |
![]() | Domain d5uncb_: 5unc B: [330292] automated match to d4iqea_ complexed with fmt, tla, xys |
PDB Entry: 5unc (more details), 1.71 Å
SCOPe Domain Sequences for d5uncb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uncb_ c.1.12.0 (B:) automated matches {Streptomyces platensis [TaxId: 58346]} hgaaqlralfdapgtvriagahnplgarlaeragfdgiwssgleisasqglpdadiltmt ellgvagsmasavgvpvvadcdtgygnannvmhmvrryeaagiaavtiedkrfpkvnsfi pgrqelasvpefcgrieaakdaqrdpdfmviariealiagwdldealrrgeayaaagada vlihaksgspqpvldflqrwhlpqpvvvvpttyhtisaaelgaagakmvvyanhglragi qavsqtfetilkdgrttaiedhiaplttvfdlqgmdefqenekrfvr
Timeline for d5uncb_: