Lineage for d5uncb_ (5unc B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100415Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2100416Protein automated matches [190614] (15 species)
    not a true protein
  7. 2100493Species Streptomyces platensis [TaxId:58346] [330207] (1 PDB entry)
  8. 2100495Domain d5uncb_: 5unc B: [330292]
    automated match to d4iqea_
    complexed with fmt, tla, xys

Details for d5uncb_

PDB Entry: 5unc (more details), 1.71 Å

PDB Description: the crystal structure of phosphoenolpyruvate phosphomutase from streptomyces platensis subsp. rosaceus
PDB Compounds: (B:) Phosphoenolpyruvate phosphomutase

SCOPe Domain Sequences for d5uncb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uncb_ c.1.12.0 (B:) automated matches {Streptomyces platensis [TaxId: 58346]}
hgaaqlralfdapgtvriagahnplgarlaeragfdgiwssgleisasqglpdadiltmt
ellgvagsmasavgvpvvadcdtgygnannvmhmvrryeaagiaavtiedkrfpkvnsfi
pgrqelasvpefcgrieaakdaqrdpdfmviariealiagwdldealrrgeayaaagada
vlihaksgspqpvldflqrwhlpqpvvvvpttyhtisaaelgaagakmvvyanhglragi
qavsqtfetilkdgrttaiedhiaplttvfdlqgmdefqenekrfvr

SCOPe Domain Coordinates for d5uncb_:

Click to download the PDB-style file with coordinates for d5uncb_.
(The format of our PDB-style files is described here.)

Timeline for d5uncb_: