Lineage for d5t2pc_ (5t2p C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002386Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2002387Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) (S)
    automatically mapped to Pfam PF00906
  5. 2002388Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2002395Protein automated matches [191131] (3 species)
    not a true protein
  7. 2002403Species Hepatitis B virus [TaxId:10407] [256206] (5 PDB entries)
  8. 2002405Domain d5t2pc_: 5t2p C: [330286]
    Other proteins in same PDB: d5t2pb2, d5t2pd2
    automated match to d4bmga_
    complexed with cl, dms, gol, ipa, k89; mutant

Details for d5t2pc_

PDB Entry: 5t2p (more details), 1.69 Å

PDB Description: hepatitis b virus core protein y132a mutant in complex with sulfamoylbenzamide (sba_r01)
PDB Compounds: (C:) Core protein

SCOPe Domain Sequences for d5t2pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t2pc_ a.62.1.1 (C:) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst

SCOPe Domain Coordinates for d5t2pc_:

Click to download the PDB-style file with coordinates for d5t2pc_.
(The format of our PDB-style files is described here.)

Timeline for d5t2pc_: