Class a: All alpha proteins [46456] (289 folds) |
Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) automatically mapped to Pfam PF00906 |
Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
Protein automated matches [191131] (3 species) not a true protein |
Species Hepatitis B virus [TaxId:10407] [256206] (5 PDB entries) |
Domain d5t2pc_: 5t2p C: [330286] Other proteins in same PDB: d5t2pb2, d5t2pd2 automated match to d4bmga_ complexed with cl, dms, gol, ipa, k89; mutant |
PDB Entry: 5t2p (more details), 1.69 Å
SCOPe Domain Sequences for d5t2pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t2pc_ a.62.1.1 (C:) automated matches {Hepatitis B virus [TaxId: 10407]} mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv sfgvwirtppaarppnapilst
Timeline for d5t2pc_:
View in 3D Domains from other chains: (mouse over for more information) d5t2pb1, d5t2pb2, d5t2pd1, d5t2pd2 |