Lineage for d5uswa1 (5usw A:1-278)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101987Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2101988Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 2102093Protein automated matches [194480] (6 species)
    not a true protein
  7. 2102103Species Vibrio fischeri [TaxId:312309] [330242] (1 PDB entry)
  8. 2102104Domain d5uswa1: 5usw A:1-278 [330284]
    Other proteins in same PDB: d5uswa2, d5uswb2, d5uswc2, d5uswd2
    automated match to d1aj2a_
    complexed with act, fmt, gol

Details for d5uswa1

PDB Entry: 5usw (more details), 1.64 Å

PDB Description: the crystal structure of 7,8-dihydropteroate synthase from vibrio fischeri es114
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d5uswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uswa1 c.1.21.1 (A:1-278) automated matches {Vibrio fischeri [TaxId: 312309]}
mklisknksllldrshvmgilnvtpdsfsdggqfthldaalkqaekmvkagvsfidigge
strpgapevslqeeldrvlpiieaihqrfdtwisidtskavvmeeavkvgadlindvral
qepnalkvaaeanvpvclmhmqgqprtmqtnpsyqdlftdissflseridacqsvgiakd
klildpgfgfgktlahnyqllaelerfhqfglpllagmsrksmvfklldvepkmalsgsl
acatiaamkgaqiirvhdfeqtmdivkvcqatleqsph

SCOPe Domain Coordinates for d5uswa1:

Click to download the PDB-style file with coordinates for d5uswa1.
(The format of our PDB-style files is described here.)

Timeline for d5uswa1: