Lineage for d1byec2 (1bye C:1-80)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24386Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)
  8. 24391Domain d1byec2: 1bye C:1-80 [33028]
    Other proteins in same PDB: d1byea1, d1byeb1, d1byec1, d1byed1

Details for d1byec2

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

SCOP Domain Sequences for d1byec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byec2 c.47.1.5 (C:1-80) Glutathione S-transferase {Maize (Zea mays), type I}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

SCOP Domain Coordinates for d1byec2:

Click to download the PDB-style file with coordinates for d1byec2.
(The format of our PDB-style files is described here.)

Timeline for d1byec2: