SCOPe 2.06: Domain d5tuya_: 5tuy A:

Lineage for d5tuya_ (5tuy A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.0: automated matches [227191] (1 protein)
   not a true family

6. Protein automated matches [226914] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225158] (21 PDB entries)

8. Domain d5tuya_: 5tuy A: [330273]
   automated match to d4nvqb_
   complexed with 7l6, sam, zn

Details for d5tuya_

PDB Entry: 5tuy, 2.6 Å

PDB Description: structure of human g9a set-domain (ehmt2) in complex with inhibitor ms0124

PDB Compounds: (A:) Histone-lysine N-methyltransferase EHMT2

SCOPe Domain Sequences for d5tuya_:

Sequence; same for both SEQRES and ATOM records:

>d5tuya_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddc
sssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrl
qlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevycid
aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
ikskyftcqcgsekckhsaeaialeqs

Timeline for d5tuya_:

• d5tuya_ is new in SCOPe 2.06-stable
  
• d5tuya_ appears in SCOPe 2.07
  
• d5tuya_ appears in the current release, SCOPe 2.08