Lineage for d5tuya_ (5tuy A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2407306Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2407384Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2407385Protein automated matches [226914] (2 species)
    not a true protein
  7. 2407386Species Human (Homo sapiens) [TaxId:9606] [225158] (23 PDB entries)
  8. 2407434Domain d5tuya_: 5tuy A: [330273]
    automated match to d4nvqb_
    complexed with 7l6, sam, zn

Details for d5tuya_

PDB Entry: 5tuy (more details), 2.6 Å

PDB Description: structure of human g9a set-domain (ehmt2) in complex with inhibitor ms0124
PDB Compounds: (A:) Histone-lysine N-methyltransferase EHMT2

SCOPe Domain Sequences for d5tuya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tuya_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvddc
sssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikvrl
qlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevycid
aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
ikskyftcqcgsekckhsaeaialeqs

SCOPe Domain Coordinates for d5tuya_:

Click to download the PDB-style file with coordinates for d5tuya_.
(The format of our PDB-style files is described here.)

Timeline for d5tuya_: