Lineage for d1byeb2 (1bye B:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876945Protein Class phi GST [81367] (3 species)
  7. 2876946Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)
  8. 2876950Domain d1byeb2: 1bye B:1-80 [33027]
    Other proteins in same PDB: d1byea1, d1byeb1, d1byec1, d1byed1
    complexed with ata

Details for d1byeb2

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate
PDB Compounds: (B:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1byeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byeb2 c.47.1.5 (B:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

SCOPe Domain Coordinates for d1byeb2:

Click to download the PDB-style file with coordinates for d1byeb2.
(The format of our PDB-style files is described here.)

Timeline for d1byeb2: