SCOPe 2.08: Domain d5ugxa_: 5ugx A:

Lineage for d5ugxa_ (5ugx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d5ugxa_: 5ugx A: [330268]
   automated match to d4v04b_
   complexed with acp, mg, so4; mutant

Details for d5ugxa_

PDB Entry: 5ugx, 2.35 Å

PDB Description: crystal structure of the tyrosine kinase domain of fgf receptor 2 harboring a e565a/d650v double gain-of-function mutation

PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d5ugxa_:

Sequence; same for both SEQRES and ATOM records:

>d5ugxa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatekd
lsdlvsememmkmigkhkniinllgactqdgplyvivayaskgnlreylrarrppgmeys
ydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfgl
arvinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgi
pveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

Timeline for d5ugxa_:

• d5ugxa_ first appeared in SCOPe 2.06
  
• d5ugxa_ appears in SCOPe 2.07