Lineage for d5x1xa_ (5x1x A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211807Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2211808Protein automated matches [191036] (16 species)
    not a true protein
  7. 2211915Species Staphylococcus aureus [TaxId:548470] [330265] (1 PDB entry)
  8. 2211916Domain d5x1xa_: 5x1x A: [330266]
    automated match to d4v14a_

Details for d5x1xa_

PDB Entry: 5x1x (more details)

PDB Description: solution nmr structure of dna mismatch repair protein mutt (family nudix hydrolase) from methicillin resistant staphylococcus aureus 252
PDB Compounds: (A:) Mutator mutT protein

SCOPe Domain Sequences for d5x1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1xa_ d.113.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 548470]}
mkkvinvvgaiifsdnkilcaqrsekmslplmwefpggkveknetekdalireireemkc
dlivgdkvitteheydfgivrlttykctlnkelptltehksiewlsineldklnwapadi
pavnkimteg

SCOPe Domain Coordinates for d5x1xa_:

Click to download the PDB-style file with coordinates for d5x1xa_.
(The format of our PDB-style files is described here.)

Timeline for d5x1xa_: