![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
![]() | Protein automated matches [191036] (17 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:548470] [330265] (1 PDB entry) |
![]() | Domain d5x1xa_: 5x1x A: [330266] automated match to d4v14a_ |
PDB Entry: 5x1x (more details)
SCOPe Domain Sequences for d5x1xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x1xa_ d.113.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 548470]} mkkvinvvgaiifsdnkilcaqrsekmslplmwefpggkveknetekdalireireemkc dlivgdkvitteheydfgivrlttykctlnkelptltehksiewlsineldklnwapadi pavnkimteg
Timeline for d5x1xa_: