Lineage for d5m7gc1 (5m7g C:1-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121690Protein automated matches [226837] (7 species)
    not a true protein
  7. 2121696Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries)
  8. 2121800Domain d5m7gc1: 5m7g C:1-245 [330253]
    Other proteins in same PDB: d5m7ga2, d5m7gb2, d5m7gc2, d5m7gd2, d5m7ge_, d5m7gf1, d5m7gf2, d5m7gf3
    automated match to d4ihja1
    complexed with acp, ca, fb7, gdp, gol, gtp, mes, mg

Details for d5m7gc1

PDB Entry: 5m7g (more details), 2.25 Å

PDB Description: tubulin-mtd147 complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5m7gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m7gc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5m7gc1:

Click to download the PDB-style file with coordinates for d5m7gc1.
(The format of our PDB-style files is described here.)

Timeline for d5m7gc1: