Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class phi GST [81367] (3 species) |
Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries) |
Domain d1axdb2: 1axd B:1-80 [33025] Other proteins in same PDB: d1axda1, d1axdb1 |
PDB Entry: 1axd (more details), 2.5 Å
SCOPe Domain Sequences for d1axdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axdb2 c.47.1.5 (B:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg dlylfesraickyaarknkp
Timeline for d1axdb2: