SCOP 1.57: Domain d1axda2: 1axd A:1-80

Lineage for d1axda2 (1axd A:1-80)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Maize (Zea mays), type I [TaxId:4577] [52881] (2 PDB entries)

8. Domain d1axda2: 1axd A:1-80 [33024]
   Other proteins in same PDB: d1axda1, d1axdb1

Details for d1axda2

PDB Entry: 1axd, 2.5 Å

PDB Description: structure of glutathione s-transferase-i bound with the ligand lactoylglutathione

SCOP Domain Sequences for d1axda2:

Sequence; same for both SEQRES and ATOM records:

>d1axda2 c.47.1.5 (A:1-80) Glutathione S-transferase {Maize (Zea mays), type I}
apmklygavmswnltrcataleeagsdyeivpinfataehkspehlvrnpfgqvpalqdg
dlylfesraickyaarknkp

Timeline for d1axda2:

• d1axda2 first appeared (with stable ids) in SCOP 1.55
  
• d1axda2 appears in SCOP 1.59
  
• d1axda2 appears in the current release, SCOPe 2.08