![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [188073] (1 PDB entry) |
![]() | Domain d5wvua_: 5wvu A: [330238] automated match to d1wgza_ complexed with gol, zn |
PDB Entry: 5wvu (more details), 2.6 Å
SCOPe Domain Sequences for d5wvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wvua_ d.92.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp rvlvervtgeapsarpflaylekkyaalyg
Timeline for d5wvua_: