Lineage for d5wvua_ (5wvu A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. Protein automated matches [190805] (19 species)
    not a true protein
  7. Species Thermus thermophilus HB8 [TaxId:300852] [188073] (1 PDB entry)
  8. Domain d5wvua_: 5wvu A: [330238]
    automated match to d1wgza_
    complexed with gol, zn

Details for d5wvua_

PDB Entry: 5wvu (more details), 2.6 Å

PDB Description: crystal structure of carboxypeptidase from thermus thermophilus
PDB Compounds: (A:) Thermostable carboxypeptidase 1

SCOPe Domain Sequences for d5wvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wvua_ d.92.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
rvlvervtgeapsarpflaylekkyaalyg

SCOPe Domain Coordinates for d5wvua_ are not available.

Timeline for d5wvua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5wvub_, d5wvuc_