Lineage for d5wreb_ (5wre B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716878Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2716879Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) (S)
    automatically mapped to Pfam PF00906
  5. 2716880Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2716887Protein automated matches [191131] (3 species)
    not a true protein
  7. 2716914Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries)
  8. 2716928Domain d5wreb_: 5wre B: [330235]
    Other proteins in same PDB: d5wred2, d5wref2
    automated match to d4bmga_
    complexed with 7tl, cl, gol, ipa; mutant

Details for d5wreb_

PDB Entry: 5wre (more details), 1.95 Å

PDB Description: hepatitis b virus core protein y132a mutant in complex with heteroaryldihydropyrimidine (hap_r01)
PDB Compounds: (B:) Core protein

SCOPe Domain Sequences for d5wreb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wreb_ a.62.1.1 (B:) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst

SCOPe Domain Coordinates for d5wreb_:

Click to download the PDB-style file with coordinates for d5wreb_.
(The format of our PDB-style files is described here.)

Timeline for d5wreb_: