Lineage for d1gnwb2 (1gnw B:2-85)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132377Protein Class phi GST [81367] (3 species)
  7. 2132387Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries)
  8. 2132389Domain d1gnwb2: 1gnw B:2-85 [33022]
    Other proteins in same PDB: d1gnwa1, d1gnwb1
    complexed with gtx

Details for d1gnwb2

PDB Entry: 1gnw (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1gnwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnwb2 c.47.1.5 (B:2-85) Class phi GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl

SCOPe Domain Coordinates for d1gnwb2:

Click to download the PDB-style file with coordinates for d1gnwb2.
(The format of our PDB-style files is described here.)

Timeline for d1gnwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnwb1