| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class phi GST [81367] (3 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52880] (2 PDB entries) |
| Domain d1gnwb2: 1gnw B:2-85 [33022] Other proteins in same PDB: d1gnwa1, d1gnwb1 complexed with gtx |
PDB Entry: 1gnw (more details), 2.2 Å
SCOPe Domain Sequences for d1gnwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnwb2 c.47.1.5 (B:2-85) Class phi GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
lklfesraitqyiahryenqgtnl
Timeline for d1gnwb2: