SCOPe 2.07: Domain d5tzcb1: 5tzc B:579-918

Lineage for d5tzcb1 (5tzc B:579-918)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5tzcb1: 5tzc B:579-918 [330217]
   Other proteins in same PDB: d5tzca2, d5tzcb2, d5tzcc2
   automated match to d4d09a_
   complexed with 7oj, mg, zn

Details for d5tzcb1

PDB Entry: 5tzc, 2.36 Å

PDB Description: crystal structure of human pde2a in complex with (5s)-1-[(3-bromo-4- fluorophenyl)carbonyl]-3,3-difluoro-5-{5-methyl-[1,2,4]triazolo[1,5- a]pyrimidin-7-yl}piperidine

PDB Compounds: (B:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tzcb1:

Sequence; same for both SEQRES and ATOM records:

>d5tzcb1 a.211.1.0 (B:579-918) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldflde

Timeline for d5tzcb1:

• d5tzcb1 first appeared in SCOPe 2.06
  
• d5tzcb1 appears in the current release, SCOPe 2.08