Lineage for d5tzcb1 (5tzc B:579-918)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 2737463Domain d5tzcb1: 5tzc B:579-918 [330217]
    Other proteins in same PDB: d5tzca2, d5tzcb2, d5tzcc2
    automated match to d4d09a_
    complexed with 7oj, mg, zn

Details for d5tzcb1

PDB Entry: 5tzc (more details), 2.36 Å

PDB Description: crystal structure of human pde2a in complex with (5s)-1-[(3-bromo-4- fluorophenyl)carbonyl]-3,3-difluoro-5-{5-methyl-[1,2,4]triazolo[1,5- a]pyrimidin-7-yl}piperidine
PDB Compounds: (B:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tzcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tzcb1 a.211.1.0 (B:579-918) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldflde

SCOPe Domain Coordinates for d5tzcb1:

Click to download the PDB-style file with coordinates for d5tzcb1.
(The format of our PDB-style files is described here.)

Timeline for d5tzcb1: