Lineage for d1fhea2 (1fhe A:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876600Protein Class alpha GST [81360] (8 species)
  7. 2876609Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries)
  8. 2876612Domain d1fhea2: 1fhe A:1-80 [33020]
    Other proteins in same PDB: d1fhea1
    complexed with gsh

Details for d1fhea2

PDB Entry: 1fhe (more details), 3 Å

PDB Description: glutathione transferase (fh47) from fasciola hepatica
PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d1fhea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]}
paklgywklrglaqpvrlfleylgeeyeehlygrddrekwmsekfnmgldlpnlpyyidd
kckltqsvaimryiadkhgm

SCOPe Domain Coordinates for d1fhea2:

Click to download the PDB-style file with coordinates for d1fhea2.
(The format of our PDB-style files is described here.)

Timeline for d1fhea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fhea1