SCOPe 2.07: Domain d5u00d_: 5u00 D:

Lineage for d5u00d_ (5u00 D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5u00d_: 5u00 D: [330197]
   Other proteins in same PDB: d5u00a2, d5u00b2, d5u00c2
   automated match to d4d09a_
   complexed with 7ov, mg, zn

Details for d5u00d_

PDB Entry: 5u00, 1.41 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with 3,3- difluoro-1-[(4-fluoro-3-iodophenyl)carbonyl]-5-{5-methyl-[1,2, 4]triazolo[1,5-a]pyrimidin-7-yl}piperidine

PDB Compounds: (D:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5u00d_:

Sequence; same for both SEQRES and ATOM records:

>d5u00d_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptla
rfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldh
rgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldl
mrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttr
kiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpk
aaelyervasnrehwtkvshkftirglpsnnsldfl

Timeline for d5u00d_:

• d5u00d_ first appeared in SCOPe 2.06
  
• d5u00d_ appears in the current release, SCOPe 2.08