SCOPe 2.08: Domain d5u00c1: 5u00 C:579-916

Lineage for d5u00c1 (5u00 C:579-916)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d5u00c1: 5u00 C:579-916 [330184]
   Other proteins in same PDB: d5u00a2, d5u00b2, d5u00c2
   automated match to d4d09a_
   complexed with 7ov, mg, zn

Details for d5u00c1

PDB Entry: 5u00, 1.41 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with 3,3- difluoro-1-[(4-fluoro-3-iodophenyl)carbonyl]-5-{5-methyl-[1,2, 4]triazolo[1,5-a]pyrimidin-7-yl}piperidine

PDB Compounds: (C:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5u00c1:

Sequence; same for both SEQRES and ATOM records:

>d5u00c1 a.211.1.0 (C:579-916) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfl

Timeline for d5u00c1:

• d5u00c1 first appeared in SCOPe 2.06
  
• d5u00c1 appears in SCOPe 2.07