SCOPe 2.08: Domain d5tp3a1: 5tp3 A:6-113

Lineage for d5tp3a1 (5tp3 A:6-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5tp3a1: 5tp3 A:6-113 [330182]
   Other proteins in same PDB: d5tp3a2, d5tp3b2
   automated match to d4grwe_

Details for d5tp3a1

PDB Entry: 5tp3, 1.87 Å

PDB Description: crystal structure of the rsv-neutralizing single-domain antibody f- vhh-4

PDB Compounds: (A:) f-vhh-4

SCOPe Domain Sequences for d5tp3a1:

Sequence; same for both SEQRES and ATOM records:

>d5tp3a1 b.1.1.1 (A:6-113) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftldyyyigwfrqapgkereavscisgssgstyypdsvk
grftisrdnakntvylqmnslkpedtavyycatirssswggcvhygmdywgkgtqvtvss

Timeline for d5tp3a1:

• d5tp3a1 first appeared in SCOPe 2.06, called d5tp3a_
  
• d5tp3a1 appears in SCOPe 2.07