Lineage for d5m7ec2 (5m7e C:246-440)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) 
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries) 
Domain d5m7ec2: 5m7e C:246-440 [330181]
Other proteins in same PDB: d5m7ea1, d5m7eb1, d5m7ec1, d5m7ed1, d5m7ee_, d5m7ef1, d5m7ef2, d5m7ef3
automated match to d4i50a2
complexed with acp, ca, gdp, gol, gtp, mes, mg, sd5
Details for d5m7ec2
PDB Entry: 5m7e (more details), 2.05 Å
PDB Description: tubulin-bkm120 complex
PDB Compounds: (C:) Tubulin alpha-1B chainSCOPe Domain Sequences for d5m7ec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m7ec2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv
SCOPe Domain Coordinates for d5m7ec2:
Click to download the PDB-style file with coordinates for d5m7ec2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5m7ec2:
View in 3D
