SCOPe 2.07: Domain d5tzhb1: 5tzh B:579-916

Lineage for d5tzhb1 (5tzh B:579-916)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5tzhb1: 5tzh B:579-916 [330178]
   Other proteins in same PDB: d5tzha2, d5tzhb2
   automated match to d4d09a_
   complexed with 7op, mg, zn

Details for d5tzhb1

PDB Entry: 5tzh, 1.6 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with 3,3- difluoro-1-[(4-fluorophenyl)carbonyl]-5-{5-methyl-[1,2,4]triazolo[1, 5-a]pyrimidin-7-yl}piperidine

PDB Compounds: (B:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tzhb1:

Sequence; same for both SEQRES and ATOM records:

>d5tzhb1 a.211.1.0 (B:579-916) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfl

Timeline for d5tzhb1:

• d5tzhb1 first appeared in SCOPe 2.06
  
• d5tzhb1 appears in the current release, SCOPe 2.08