SCOPe 2.03: Domain d1bg5a2: 1bg5 A:1-80

Lineage for d1bg5a2 (1bg5 A:1-80)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (14 PDB entries)
   Uniprot P08515

8. Domain d1bg5a2: 1bg5 A:1-80 [33017]
   Other proteins in same PDB: d1bg5a1

Details for d1bg5a2

PDB Entry: 1bg5, 2.6 Å

PDB Description: crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase

PDB Compounds: (A:) fusion protein of alpha-na,k-ATPase with glutathione s-transferase

SCOPe Domain Sequences for d1bg5a2:

Sequence; same for both SEQRES and ATOM records:

>d1bg5a2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

Timeline for d1bg5a2:

• d1bg5a2 first appeared (with stable ids) in SCOP 1.55, called d1bg5_2
  
• d1bg5a2 appears in SCOPe 2.02
  
• d1bg5a2 appears in SCOPe 2.04
  
• d1bg5a2 appears in the current release, SCOPe 2.08