![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (9 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
![]() | Domain d5m8gd1: 5m8g D:2-245 [330168] Other proteins in same PDB: d5m8ga2, d5m8gb2, d5m8gc2, d5m8gd2, d5m8ge_, d5m8gf1, d5m8gf2, d5m8gf3 automated match to d4drxb1 complexed with 918, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5m8g (more details), 2.15 Å
SCOPe Domain Sequences for d5m8gd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m8gd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d5m8gd1: