Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries) |
Domain d5tzxc_: 5tzx C: [330161] Other proteins in same PDB: d5tzxa2 automated match to d4d09a_ complexed with 7oy, mg, zn |
PDB Entry: 5tzx (more details), 1.9 Å
SCOPe Domain Sequences for d5tzxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tzxc_ a.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmvkkg yrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnnsfqv asksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiilatd lahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeliyke ffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaelyerva snrehwtkvshkftirglpsnnsldfl
Timeline for d5tzxc_:
View in 3D Domains from other chains: (mouse over for more information) d5tzxa1, d5tzxa2, d5tzxb_, d5tzxd_ |