SCOPe 2.02: Domain d1gtba2: 1gtb A:1-80

Lineage for d1gtba2 (1gtb A:1-80)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (12 PDB entries)
   Uniprot P08515

8. Domain d1gtba2: 1gtb A:1-80 [33016]
   Other proteins in same PDB: d1gtba1
   complexed with pzq

Details for d1gtba2

PDB Entry: 1gtb, 2.6 Å

PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gtba2:

Sequence; same for both SEQRES and ATOM records:

>d1gtba2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

Timeline for d1gtba2:

• d1gtba2 first appeared (with stable ids) in SCOP 1.55, called d1gtb_2
  
• d1gtba2 appears in SCOPe 2.01
  
• d1gtba2 appears in SCOPe 2.03
  
• d1gtba2 appears in the current release, SCOPe 2.08