Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [330028] (2 PDB entries) |
Domain d5itvc1: 5itv C:3-255 [330159] Other proteins in same PDB: d5itva2, d5itvb2, d5itvc2, d5itvd2 automated match to d4za2a_ complexed with nai |
PDB Entry: 5itv (more details), 2.26 Å
SCOPe Domain Sequences for d5itvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5itvc1 c.2.1.0 (C:3-255) automated matches {Bacillus subtilis [TaxId: 224308]} mnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvqtd itdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflmsk halkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvncv cpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssymt gsaitadggytaq
Timeline for d5itvc1: