SCOPe 2.08: Domain d5tzzc_: 5tzz C:

Lineage for d5tzzc_ (5tzz C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d5tzzc_: 5tzz C: [330157]
   Other proteins in same PDB: d5tzza2, d5tzzb2
   automated match to d4d09a_
   complexed with 7oj, mg, zn

Details for d5tzzc_

PDB Entry: 5tzz, 1.6 Å

PDB Description: crystal structure of human phosphodiesterase 2a in complex with 1-[(3- bromo-4-fluorophenyl)carbonyl]-3,3-difluoro-5-{5-methyl-[1,2, 4]triazolo[1,5-a]pyrimidin-7-yl}piperidine

PDB Compounds: (C:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5tzzc_:

Sequence; same for both SEQRES and ATOM records:

>d5tzzc_ a.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmvkkg
yrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnnsfqv
asksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiilatd
lahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeliyke
ffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaelyerva
snrehwtkvshkftirglpsnnsldfl

Timeline for d5tzzc_:

• d5tzzc_ first appeared in SCOPe 2.06
  
• d5tzzc_ appears in SCOPe 2.07