SCOPe 2.08: Domain d5tupb2: 5tup B:127-254

Lineage for d5tupb2 (5tup B:127-254)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Aspergillus fumigatus [TaxId:1437362] [330141] (1 PDB entry)

8. Domain d5tupb2: 5tup B:127-254 [330155]
   Other proteins in same PDB: d5tupc3
   automated match to d1plqa2

Details for d5tupb2

PDB Entry: 5tup, 2.6 Å

PDB Description: x-ray crystal structure of the aspergillus fumigatus sliding clamp

PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5tupb2:

Sequence; same for both SEQRES and ATOM records:

>d5tupb2 d.131.1.0 (B:127-254) automated matches {Aspergillus fumigatus [TaxId: 1437362]}
aipeteyaatvempsaefqricrdlnalsesvvieatkegvkfscqgdigsgsvtirqht
svdkpeqnvsialsepvaltfslkylvnfckatslsskvtlclsqevpllveyglgsghl
rfylapki

Timeline for d5tupb2:

• d5tupb2 first appeared in SCOPe 2.06
  
• d5tupb2 appears in SCOPe 2.07