| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
| Protein automated matches [226907] (28 species) not a true protein |
| Species Aspergillus fumigatus [TaxId:1437362] [330141] (1 PDB entry) |
| Domain d5tupb1: 5tup B:1-126 [330154] Other proteins in same PDB: d5tupc3 automated match to d1plqa1 |
PDB Entry: 5tup (more details), 2.6 Å
SCOPe Domain Sequences for d5tupb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tupb1 d.131.1.0 (B:1-126) automated matches {Aspergillus fumigatus [TaxId: 1437362]}
mlearleqasllkrvvdaikdlvqdcnfdcndsgialqamdnshvalvsmllkaegfspy
rcdrnialginlvsltkvlraaqnediltlkaddspdavnlmfesaetdriseydiklmd
idqehl
Timeline for d5tupb1: