![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (28 species) not a true protein |
![]() | Species Aspergillus fumigatus [TaxId:1437362] [330141] (1 PDB entry) |
![]() | Domain d5tupa1: 5tup A:1-126 [330152] Other proteins in same PDB: d5tupc3 automated match to d1plqa1 |
PDB Entry: 5tup (more details), 2.6 Å
SCOPe Domain Sequences for d5tupa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tupa1 d.131.1.0 (A:1-126) automated matches {Aspergillus fumigatus [TaxId: 1437362]} mlearleqasllkrvvdaikdlvqdcnfdcndsgialqamdnshvalvsmllkaegfspy rcdrnialginlvsltkvlraaqnediltlkaddspdavnlmfesaetdriseydiklmd idqehl
Timeline for d5tupa1: