Lineage for d5tupa1 (5tup A:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977282Species Aspergillus fumigatus [TaxId:1437362] [330141] (1 PDB entry)
  8. 2977283Domain d5tupa1: 5tup A:1-126 [330152]
    Other proteins in same PDB: d5tupc3
    automated match to d1plqa1

Details for d5tupa1

PDB Entry: 5tup (more details), 2.6 Å

PDB Description: x-ray crystal structure of the aspergillus fumigatus sliding clamp
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5tupa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tupa1 d.131.1.0 (A:1-126) automated matches {Aspergillus fumigatus [TaxId: 1437362]}
mlearleqasllkrvvdaikdlvqdcnfdcndsgialqamdnshvalvsmllkaegfspy
rcdrnialginlvsltkvlraaqnediltlkaddspdavnlmfesaetdriseydiklmd
idqehl

SCOPe Domain Coordinates for d5tupa1:

Click to download the PDB-style file with coordinates for d5tupa1.
(The format of our PDB-style files is described here.)

Timeline for d5tupa1: