Lineage for d1gnea2 (1gne A:1-79)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992326Protein Class alpha GST [81360] (8 species)
  7. 992423Species Schistosoma japonicum [TaxId:6182] [52878] (12 PDB entries)
    Uniprot P08515
  8. 992432Domain d1gnea2: 1gne A:1-79 [33015]
    Other proteins in same PDB: d1gnea1
    complexed with gsw

Details for d1gnea2

PDB Entry: 1gne (more details), 2.5 Å

PDB Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gnea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnea2 c.47.1.5 (A:1-79) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhn

SCOPe Domain Coordinates for d1gnea2:

Click to download the PDB-style file with coordinates for d1gnea2.
(The format of our PDB-style files is described here.)

Timeline for d1gnea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnea1