SCOPe 2.08: Domain d5luvb1: 5luv B:1-137

Lineage for d5luvb1 (5luv B:1-137)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [256090] (4 PDB entries)

8. Domain d5luvb1: 5luv B:1-137 [330133]
   Other proteins in same PDB: d5luvb2
   automated match to d3sw1a_
   complexed with cl, so4

Details for d5luvb1

PDB Entry: 5luv, 2.5 Å

PDB Description: short lov protein w619_1 in apo-state

PDB Compounds: (B:) Putative PAS/PAC sensor protein

SCOPe Domain Sequences for d5luvb1:

Sequence; same for both SEQRES and ATOM records:

>d5luvb1 d.110.3.0 (B:1-137) automated matches {Pseudomonas putida [TaxId: 160488]}
minaqllqsmvdasndgivvaeqegddtiliyvnpaferltgysrdeilyqdcrflqgdd
rdqlararirkalaegrpcrevlrnyrkdgsafwnelsitpvkcdadhrtyfigiqkdvs
rqvelerelaemhvrrn

Timeline for d5luvb1:

• d5luvb1 first appeared in SCOPe 2.06
  
• d5luvb1 appears in SCOPe 2.07