Lineage for d1dugb2 (1dug B:1-80)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2117361Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2117372Protein Class alpha GST [81360] (8 species)
  7. 2117498Species Schistosoma japonicum [TaxId:6182] [52878] (14 PDB entries)
    Uniprot P08515
  8. 2117500Domain d1dugb2: 1dug B:1-80 [33013]
    Other proteins in same PDB: d1duga1, d1dugb1
    complexed with gsh

Details for d1dugb2

PDB Entry: 1dug (more details), 1.8 Å

PDB Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization
PDB Compounds: (B:) chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN

SCOPe Domain Sequences for d1dugb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dugb2 c.47.1.5 (B:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhnm

SCOPe Domain Coordinates for d1dugb2:

Click to download the PDB-style file with coordinates for d1dugb2.
(The format of our PDB-style files is described here.)

Timeline for d1dugb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dugb1