Lineage for d1duga2 (1dug A:1-80)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 244927Protein Class alpha GST [81360] (6 species)
  7. 244982Species Schistosoma japonicum [TaxId:6182] [52878] (5 PDB entries)
  8. 244983Domain d1duga2: 1dug A:1-80 [33012]
    Other proteins in same PDB: d1duga1, d1dugb1

Details for d1duga2

PDB Entry: 1dug (more details), 1.8 Å

PDB Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization

SCOP Domain Sequences for d1duga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhnm

SCOP Domain Coordinates for d1duga2:

Click to download the PDB-style file with coordinates for d1duga2.
(The format of our PDB-style files is described here.)

Timeline for d1duga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1duga1