SCOPe 2.08: Domain d5t2pb1: 5t2p B:1-149

Lineage for d5t2pb1 (5t2p B:1-149)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
   5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle

4. Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families)
   automatically mapped to Pfam PF00906

5. Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)

6. Protein automated matches [191131] (3 species)
   not a true protein

7. Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries)

8. Domain d5t2pb1: 5t2p B:1-149 [330117]
   Other proteins in same PDB: d5t2pa2, d5t2pb2, d5t2pd2, d5t2pe2, d5t2pf2
   automated match to d4bmga_
   complexed with cl, dms, gol, ipa, k89; mutant

Details for d5t2pb1

PDB Entry: 5t2p, 1.69 Å

PDB Description: hepatitis b virus core protein y132a mutant in complex with sulfamoylbenzamide (sba_r01)

PDB Compounds: (B:) Core protein

SCOPe Domain Sequences for d5t2pb1:

Sequence; same for both SEQRES and ATOM records:

>d5t2pb1 a.62.1.1 (B:1-149) automated matches {Hepatitis B virus [TaxId: 10407]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilstlpettvv

Timeline for d5t2pb1:

• d5t2pb1 first appeared in SCOPe 2.06
  
• d5t2pb1 appears in SCOPe 2.07