SCOPe 2.06: Domain d5t2ya_: 5t2y A:

Lineage for d5t2ya_ (5t2y A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.8: PglD-like [159280] (2 proteins)
   contains extra N-terminal alpha/beta subdomain
   this is a repeat family; one repeat unit is 2npo A:101-119 found in domain

6. Protein automated matches [330112] (1 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [330113] (2 PDB entries)

8. Domain d5t2ya_: 5t2y A: [330114]
   automated match to d3bfpa_
   complexed with 753, dms, gol

Details for d5t2ya_

PDB Entry: 5t2y, 1.94 Å

PDB Description: crystal structure of c. jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid

PDB Compounds: (A:) UDP-N-acetylbacillosamine N-acetyltransferase

SCOPe Domain Sequences for d5t2ya_:

Sequence, based on SEQRES records:

>d5t2ya_ b.81.1.8 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
artekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneir
kkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntss
viehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknq
dekgvfvgvpakrm

Sequence, based on observed residues (ATOM records):

>d5t2ya_ b.81.1.8 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
artekiyiygasghglvcedvaknmgykeciflddfmkfestlpkydffiaignneirkk
iyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvi
ehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqde
kgvfvgvpakrm

Timeline for d5t2ya_:

• d5t2ya_ is new in SCOPe 2.06-stable
  
• d5t2ya_ appears in SCOPe 2.07
  
• d5t2ya_ appears in the current release, SCOPe 2.08