Lineage for d5m9rb_ (5m9r B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174511Protein Angiogenin [54094] (2 species)
  7. 2174515Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries)
  8. 2174521Domain d5m9rb_: 5m9r B: [330111]
    automated match to d1a4yb_
    complexed with peg, tar, tla

Details for d5m9rb_

PDB Entry: 5m9r (more details), 1.44 Å

PDB Description: human angiogenin als variant f100i
PDB Compounds: (B:) angiogenin

SCOPe Domain Sequences for d5m9rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m9rb_ d.5.1.1 (B:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
qdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
ngnphrenlriskssfqvttcklhggspwppcqyratagirnvvvacenglpvhldqsif
r

SCOPe Domain Coordinates for d5m9rb_:

Click to download the PDB-style file with coordinates for d5m9rb_.
(The format of our PDB-style files is described here.)

Timeline for d5m9rb_: