Lineage for d2nboa_ (2nbo A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041793Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2041794Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2041795Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2041816Species Human (Homo sapiens) [TaxId:9606] [49475] (276 PDB entries)
    Uniprot P02766 31-143
  8. 2042410Domain d2nboa_: 2nbo A: [330110]
    automated match to d1ttca_

Details for d2nboa_

PDB Entry: 2nbo (more details)

PDB Description: solution structure of the f87m/l110m variant of transthyretin in the monomeric state
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d2nboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nboa_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
vvtnpke

SCOPe Domain Coordinates for d2nboa_:

Click to download the PDB-style file with coordinates for d2nboa_.
(The format of our PDB-style files is described here.)

Timeline for d2nboa_: