Lineage for d1eema2 (1eem A:5-102)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71003Species Human (Homo sapiens), class omega [TaxId:9606] [52877] (1 PDB entry)
  8. 71004Domain d1eema2: 1eem A:5-102 [33011]
    Other proteins in same PDB: d1eema1

Details for d1eema2

PDB Entry: 1eem (more details), 2 Å

PDB Description: glutathione transferase from homo sapiens

SCOP Domain Sequences for d1eema2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eema2 c.47.1.5 (A:5-102) Glutathione S-transferase {Human (Homo sapiens), class omega}
sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
kknpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOP Domain Coordinates for d1eema2:

Click to download the PDB-style file with coordinates for d1eema2.
(The format of our PDB-style files is described here.)

Timeline for d1eema2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eema1