Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins) |
Protein Glutathione S-transferase [52863] (24 species) |
Species Human (Homo sapiens), class omega [TaxId:9606] [52877] (1 PDB entry) |
Domain d1eema2: 1eem A:5-102 [33011] Other proteins in same PDB: d1eema1 |
PDB Entry: 1eem (more details), 2 Å
SCOP Domain Sequences for d1eema2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eema2 c.47.1.5 (A:5-102) Glutathione S-transferase {Human (Homo sapiens), class omega} sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff kknpfglvpvlensqgqliyesaitceyldeaypgkkl
Timeline for d1eema2: