Lineage for d5ilsa_ (5ils A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. Protein automated matches [190154] (91 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)
  8. Domain d5ilsa_: 5ils A: [330109]
    automated match to d1awca_

Details for d5ilsa_

PDB Entry: 5ils (more details), 1.4 Å

PDB Description: autoinhibited etv1
PDB Compounds: (A:) ets translocation variant 1

SCOPe Domain Sequences for d5ilsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ilsa_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl
ryyyekgimqkvageryvykfvcdpealfsmafpdnqrpll

SCOPe Domain Coordinates for d5ilsa_ are not available.

Timeline for d5ilsa_: