Lineage for d5m9ga_ (5m9g A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928043Protein Angiogenin [54094] (2 species)
  7. 2928047Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries)
  8. 2928094Domain d5m9ga_: 5m9g A: [330106]
    automated match to d1a4yb_
    complexed with peg, tar

Details for d5m9ga_

PDB Entry: 5m9g (more details), 2.28 Å

PDB Description: human angiogenin pd variant k54r
PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d5m9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m9ga_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
dnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsiraicenkn
gnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifr

SCOPe Domain Coordinates for d5m9ga_:

Click to download the PDB-style file with coordinates for d5m9ga_.
(The format of our PDB-style files is described here.)

Timeline for d5m9ga_: