Lineage for d1gsqa2 (1gsq A:1-75)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1853303Protein Class sigma GST [81362] (5 species)
  7. 1853346Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries)
  8. 1853348Domain d1gsqa2: 1gsq A:1-75 [33010]
    Other proteins in same PDB: d1gsqa1
    complexed with gdn

Details for d1gsqa2

PDB Entry: 1gsq (more details), 2.4 Å

PDB Description: three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gsqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg

SCOPe Domain Coordinates for d1gsqa2:

Click to download the PDB-style file with coordinates for d1gsqa2.
(The format of our PDB-style files is described here.)

Timeline for d1gsqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsqa1