| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class sigma GST [81362] (5 species) |
| Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries) |
| Domain d1gsqa2: 1gsq A:1-75 [33010] Other proteins in same PDB: d1gsqa1 complexed with gdn |
PDB Entry: 1gsq (more details), 2.4 Å
SCOPe Domain Sequences for d1gsqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg
Timeline for d1gsqa2: