Lineage for d1pd222 (1pd2 2:1-75)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396311Protein Class sigma GST [81362] (4 species)
  7. 396324Species Rat (Rattus norvegicus) [TaxId:10116] [52875] (1 PDB entry)
    synonym: hematopoietic prostaglandin D synthase
  8. 396326Domain d1pd222: 1pd2 2:1-75 [33008]
    Other proteins in same PDB: d1pd211, d1pd221
    complexed with gtt

Details for d1pd222

PDB Entry: 1pd2 (more details), 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

SCOP Domain Sequences for d1pd222:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd222 c.47.1.5 (2:1-75) Class sigma GST {Rat (Rattus norvegicus)}
mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
lhqslaiaryltknt

SCOP Domain Coordinates for d1pd222:

Click to download the PDB-style file with coordinates for d1pd222.
(The format of our PDB-style files is described here.)

Timeline for d1pd222:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pd221