SCOP 1.67: Domain d1pd222: 1pd2 2:1-75

Lineage for d1pd222 (1pd2 2:1-75)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class sigma GST [81362] (4 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52875] (1 PDB entry)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d1pd222: 1pd2 2:1-75 [33008]
   Other proteins in same PDB: d1pd211, d1pd221
   complexed with gtt

Details for d1pd222

PDB Entry: 1pd2, 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

SCOP Domain Sequences for d1pd222:

Sequence; same for both SEQRES and ATOM records:

>d1pd222 c.47.1.5 (2:1-75) Class sigma GST {Rat (Rattus norvegicus)}
mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
lhqslaiaryltknt

Timeline for d1pd222:

• d1pd222 first appeared (with stable ids) in SCOP 1.55
  
• d1pd222 appears in SCOP 1.65
  
• d1pd222 appears in SCOP 1.69
  
• d1pd222 appears in the current release, SCOPe 2.08