Lineage for d5m4ma1 (5m4m A:6-169)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1995156Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1995157Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 1995176Protein automated matches [230549] (2 species)
    not a true protein
  7. 1995177Species Human (Homo sapiens) [TaxId:9606] [230552] (19 PDB entries)
  8. 1995194Domain d5m4ma1: 5m4m A:6-169 [330079]
    automated match to d1y8pa1
    complexed with 7fw, cl, tf3

Details for d5m4ma1

PDB Entry: 5m4m (more details), 2.4 Å

PDB Description: application of off-rate screening in the identification of novel pan- isoform inhibitors of pyruvate dehydrogenase kinase
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d5m4ma1:

Sequence, based on SEQRES records: (download)

>d5m4ma1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd
rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg
vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Sequence, based on observed residues (ATOM records): (download)

>d5m4ma1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsapkyiehfskfspsplsmkqfldfgsnacektsftflrqelpvrlanimkeinllpdr
vlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgv
leykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d5m4ma1:

Click to download the PDB-style file with coordinates for d5m4ma1.
(The format of our PDB-style files is described here.)

Timeline for d5m4ma1: