Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) automatically mapped to Pfam PF10436 |
Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins) |
Protein automated matches [230549] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [230552] (19 PDB entries) |
Domain d5m4ma1: 5m4m A:6-169 [330079] automated match to d1y8pa1 complexed with 7fw, cl, tf3 |
PDB Entry: 5m4m (more details), 2.4 Å
SCOPe Domain Sequences for d5m4ma1:
Sequence, based on SEQRES records: (download)
>d5m4ma1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinllpd rvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqg vleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
>d5m4ma1 a.29.5.1 (A:6-169) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsapkyiehfskfspsplsmkqfldfgsnacektsftflrqelpvrlanimkeinllpdr vlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgv leykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd
Timeline for d5m4ma1: