Lineage for d5ifca_ (5ifc A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.77: PA C-terminal domain-like [254112] (1 superfamily)
    Pfam PF00603; PubMed 18615018; complex fold with N-terminal a+b domain and C-terminal all-a domain
  4. Superfamily e.77.1: PA C-terminal domain-like [254132] (1 family) (S)
  5. Family e.77.1.1: PA C-terminal domain-like [254167] (2 proteins)
  6. Protein PA C-terminal domain [254376] (4 species)
  7. Species Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [419791] (11 PDB entries)
  8. Domain d5ifca_: 5ifc A: [330073]
    automated match to d3cm8a_
    complexed with 6ar, dms

Details for d5ifca_

PDB Entry: 5ifc (more details), 2.65 Å

PDB Description: crystal structure of polymerase acid protein (pa) from influenza a virus, wilson-smith/1933 (h1n1) bound to follow on fragment ebsi-4720 1-(4-bromophenyl)-1h-imidazole
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5ifca_:

Sequence, based on SEQRES records: (download)

>d5ifca_ e.77.1.1 (A:) PA C-terminal domain {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
rplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmrtffgwkepnvvkp
hekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalgenmapekvdfddck
dvgdlkqydsdepelrslaswiqnefnkaceltdsswieldeigedaapiehiasmrrny
ftaevshcrateyimkgvyintallnascaamddfqlipmiskcrtkegrrktnlygfii
kgrshlrndtdvvnfvsmefsltdprlephkwekycvlevgdmllrsaighvsrpmflyv
rtngtskikmkwgmemrrcllqslqqiesmieaessvkekdmtkeffenksetwpvgesp
kgveegsigkvcrtllaksvfnslyaspqlegfsaesrklllivqalrdnlepgtfdlgg
lyeaieeclindpwvllnaswfnsflth

Sequence, based on observed residues (ATOM records): (download)

>d5ifca_ e.77.1.1 (A:) PA C-terminal domain {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
rplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmrtffgwkepnvvkp
hekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalgeelrslaswiqnef
nkaceltdsswieldeigedaapiehiasmrrnyftaevshcrateyimkgvyintalln
ascaamddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdvvnfvsmefsltdpr
lephkwekycvlevgdmllrsaighvsrpmflyvrtngtskikmkwgmemrrcllqslqq
iesmieaessvkekdmtkeffenkspkgveegsigkvcrtllaksvfnslyaspqlegfs
aesrklllivqalrdnlepggglyeaieeclindpwvllnaswfnsflth

SCOPe Domain Coordinates for d5ifca_ are not available.

Timeline for d5ifca_: