| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class sigma GST [81362] (5 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [52875] (3 PDB entries) synonym: hematopoietic prostaglandin D synthase |
| Domain d1pd212: 1pd2 1:1-75 [33007] Other proteins in same PDB: d1pd211, d1pd221 complexed with gsh |
PDB Entry: 1pd2 (more details), 2.3 Å
SCOPe Domain Sequences for d1pd212:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd212 c.47.1.5 (1:1-75) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
lhqslaiaryltknt
Timeline for d1pd212: