Lineage for d1pd212 (1pd2 1:1-75)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877135Protein Class sigma GST [81362] (5 species)
  7. 2877198Species Norway rat (Rattus norvegicus) [TaxId:10116] [52875] (3 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 2877203Domain d1pd212: 1pd2 1:1-75 [33007]
    Other proteins in same PDB: d1pd211, d1pd221
    complexed with gsh

Details for d1pd212

PDB Entry: 1pd2 (more details), 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione
PDB Compounds: (1:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d1pd212:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd212 c.47.1.5 (1:1-75) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
lhqslaiaryltknt

SCOPe Domain Coordinates for d1pd212:

Click to download the PDB-style file with coordinates for d1pd212.
(The format of our PDB-style files is described here.)

Timeline for d1pd212:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pd211